Transcript | Ll_transcript_59350 |
---|---|
CDS coordinates | 1454-1774 (+) |
Peptide sequence | MEELGACEVAIASSVSKFFASTLTYPHEIIRSRLQEQGHHSEKRYSGATDCVRKVFQQEGISGFYRGCAINLLRTIPATAITFTSFEMINRFLVSRFPSDTHPSIL* |
ORF Type | complete |
Blastp | Nicotinamide adenine dinucleotide transporter 1, chloroplastic from Arabidopsis with 68% of identity |
---|---|
Blastx | Nicotinamide adenine dinucleotide transporter 1, chloroplastic from Arabidopsis with 74.25% of identity |
Eggnog | solute carrier family 25 (pyrimidine nucleotide carrier(ENOG410XS20) |
Kegg | Link to kegg annotations (AT2G47490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451378.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer