Protein coding transcript 212571

• Transcript: Ll_transcript_60796
• CDS coordinates: 116-973 (+)
• Peptide sequence: MGKRKERLQNPEPFVPISDGTDSVRSSKARSKAPKQHQKEANMIESNISSKIMKEALIQMKEVQEEEDTQNNTNSAFFNGIEEPPKVEEEDDDIDGFAGFSETQSQFGGYEEEINEEDERIMEAFLSKGQGQQKSLADLVVEKIKQKDASVVSEIRPEPKMDASIIEIYKGVGDHLSKYTVGKIPKAFKHIPSMQRWEEVLYITEPEKWSANAMYQATRIFASNFGVKKAEQFYKLVLLPRVREDIRKNKRLHFALYQSLKKALYKPAAFFKGILFPLCEVYNCL*
• ORF Type: complete

Annotations of Ll_transcript_60796

• Blastp: Bystin from Bos with 40.81% of identity
• Blastx: Bystin from Homo with 53.94% of identity
• Eggnog: K14797 essential nuclear protein 1(ENOG410XPH5)
• Kegg: Link to kegg annotations (514128)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453091.1)
• Pfam: Bystin (PF05291.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;