| Transcript | Ll_transcript_60800 |
|---|---|
| CDS coordinates | 745-1086 (+) |
| Peptide sequence | MEYCGTTSYFIKLLVEKKYALPYRVVDALVAHFMRFLYETRIMPVIWHQSLLAFVQRSVICHLLCILACLRLRSMIFCQCYSMFCLAVNLSCSCFLISVHLQSAFHVCVLCGL* |
| ORF Type | complete |
| Blastp | Bystin from Nematostella with 61.4% of identity |
|---|---|
| Blastx | Bystin from Monosiga with 59.09% of identity |
| Eggnog | K14797 essential nuclear protein 1(ENOG410XPH5) |
| Kegg | Link to kegg annotations (NEMVE_v1g167370) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453091.1) |
| Pfam | Bystin (PF05291.10) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer