Protein coding transcript 2126

• Transcript: Ll_transcript_459098
• CDS coordinates: 27-581 (+)
• Peptide sequence: MVTNNHTPMYLRFGTNIRPPPKSKTIKFLQSSTSHYFVNLVDLGVNGERLHINEKILNSPDKTHKGIAIDSGAATSYISKGAYDILIKKLDNHFLKHKGEFKKEIHQQWFMYSRIKGSGFNNVPGVIFYFEGGAQLDVNPEDTFMRITLRGSSEALALAIRQTAVGFNILGAFQQVNYKFIYNIK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_459098

• Blastp: Protein ASPARTIC PROTEASE IN GUARD CELL 1 from Arabidopsis with 23.87% of identity
• Blastx: Protein ASPARTIC PROTEASE IN GUARD CELL 1 from Arabidopsis with 23.87% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AT3G18490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016186226.1)
• Pfam: Xylanase inhibitor C-terminal (PF14541.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;