Transcript | Ll_transcript_459098 |
---|---|
CDS coordinates | 27-581 (+) |
Peptide sequence | MVTNNHTPMYLRFGTNIRPPPKSKTIKFLQSSTSHYFVNLVDLGVNGERLHINEKILNSPDKTHKGIAIDSGAATSYISKGAYDILIKKLDNHFLKHKGEFKKEIHQQWFMYSRIKGSGFNNVPGVIFYFEGGAQLDVNPEDTFMRITLRGSSEALALAIRQTAVGFNILGAFQQVNYKFIYNIK |
ORF Type | 3prime_partial |
Blastp | Protein ASPARTIC PROTEASE IN GUARD CELL 1 from Arabidopsis with 23.87% of identity |
---|---|
Blastx | Protein ASPARTIC PROTEASE IN GUARD CELL 1 from Arabidopsis with 23.87% of identity |
Eggnog | aspartic(ENOG410XNV7) |
Kegg | Link to kegg annotations (AT3G18490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016186226.1) |
Pfam | Xylanase inhibitor C-terminal (PF14541.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer