Protein coding transcript 212617

• Transcript: Ll_transcript_61077
• CDS coordinates: 286-969 (+)
• Peptide sequence: MVASTSSSSMANPNFDGKGTYLIFNVGDAIFISDLNSHDKDPIKSINFGNSNPVCHAFDQDAKDGHDLLIGLSSGDVYSVSLRQQLQDVGKKLVGAQHYNKDGSVNTSRCSSIAWVPGGDGAFVVAHADGNLYVYEKNKDGAGDSSFPVIKDQTQFSVSHSRYNKSNPVARWHICQGSINSISFSNDGAYLATVGRDGYLRVFDYSKELLVCGGKSYYGALLCCAWR*
• ORF Type: complete

Annotations of Ll_transcript_61077

• Blastp: WD repeat-containing protein 20 from Homo with 33.48% of identity
• Blastx: WD repeat-containing protein 20 from Homo with 33.48% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (91833)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444349.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;