Protein coding transcript 212639

• Transcript: Ll_transcript_61051
• CDS coordinates: 42-614 (+)
• Peptide sequence: MNYNGWEGMLFIGVNAAIRYASISYVLLLYILSLIMVYVMWFTFCVLLIFSVRVSNELGLGHARATKYSVYVTVFQSLFIGIFFMAVILITRDYFAIIFTSSKSVQDAVSKLGYLLAATMVLNSVQPVISGVAVGGGWQGLVAYINVGCYYLFGLPIGFLLGYKLNLGVKVCLLYFYFHQIPIFKMEKSS*
• ORF Type: complete

Annotations of Ll_transcript_61051

• Blastp: Protein DETOXIFICATION 34 from Arabidopsis with 58.82% of identity
• Blastx: Protein DETOXIFICATION 35 from Arabidopsis with 66.48% of identity
• Eggnog: Mate efflux family protein(COG0534)
• Kegg: Link to kegg annotations (AT4G00350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451457.1)
• Pfam: MatE (PF01554.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;