Protein coding transcript 212661

• Transcript: Ll_transcript_60897
• CDS coordinates: 243-779 (+)
• Peptide sequence: MKNIMTPMQSAMPSATFLWRFKVILFLIWGFTCCKVGWDSVMRMDANLRDLFIYEAFLYYNPLLLVTMMVWLWGVNLWVFLQSSVSYPKIFGIDQNHLSHNEIWKCSTWMTIIVPTSMTTYLYLYSHGEVSLAASQPVLLYIVVAVVLIFPFDIFFLSSRFFFLRTLWRIAFPLQARF*
• ORF Type: complete

Annotations of Ll_transcript_60897

• Blastp: Phosphate transporter PHO1-2 from Oryza sativa with 29.36% of identity
• Blastx: -
• Eggnog: Xenotropic and polytropic retrovirus receptor 1(COG5409)
• Kegg: Link to kegg annotations (4331090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413407.1)
• Pfam: EXS family (PF03124.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;