Transcript | Ll_transcript_60902 |
---|---|
CDS coordinates | 243-1058 (+) |
Peptide sequence | MKNIMTPMQSAMPSATFLWRFKVILFLIWGFTCCKVGWDSVMRMDANLRDLFIYEAFLYYNPLLLVTMMVWLWGVNLWVFLQSSVSYPKIFGIDQNHLSHNEIWKCSTWMTIIVPTSMTTYLYLYSHGEVSLAASQPVLLYIVVAVVLIFPFDIFFLSSRFFFLRTLWRIAFPLQPITFPDFFVADILTSMAKVFSDLERSVCRMVNRQVATIAWLEADSVCGSHSIAIPMVLVLPYLWRLLQCLRQYSDTKEKTCLFNGNCSVTFPPSVL* |
ORF Type | complete |
Blastp | SPX and EXS domain-containing protein 1 from Dictyostelium with 34.33% of identity |
---|---|
Blastx | SPX and EXS domain-containing protein 1 from Dictyostelium with 34.5% of identity |
Eggnog | Xenotropic and polytropic retrovirus receptor 1(COG5409) |
Kegg | Link to kegg annotations (DDB_G0271664) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413407.1) |
Pfam | EXS family (PF03124.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer