Protein coding transcript 212662

• Transcript: Ll_transcript_60902
• CDS coordinates: 243-1058 (+)
• Peptide sequence: MKNIMTPMQSAMPSATFLWRFKVILFLIWGFTCCKVGWDSVMRMDANLRDLFIYEAFLYYNPLLLVTMMVWLWGVNLWVFLQSSVSYPKIFGIDQNHLSHNEIWKCSTWMTIIVPTSMTTYLYLYSHGEVSLAASQPVLLYIVVAVVLIFPFDIFFLSSRFFFLRTLWRIAFPLQPITFPDFFVADILTSMAKVFSDLERSVCRMVNRQVATIAWLEADSVCGSHSIAIPMVLVLPYLWRLLQCLRQYSDTKEKTCLFNGNCSVTFPPSVL*
• ORF Type: complete

Annotations of Ll_transcript_60902

• Blastp: SPX and EXS domain-containing protein 1 from Dictyostelium with 34.33% of identity
• Blastx: SPX and EXS domain-containing protein 1 from Dictyostelium with 34.5% of identity
• Eggnog: Xenotropic and polytropic retrovirus receptor 1(COG5409)
• Kegg: Link to kegg annotations (DDB_G0271664)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413407.1)
• Pfam: EXS family (PF03124.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;