Protein coding transcript 212719

• Transcript: Ll_transcript_60725
• CDS coordinates: 89-901 (+)
• Peptide sequence: MEEQGSSNMNTKQHHNQGTTTTTNNNNAYVDTTKAERAVWLLKCPSMVSRSLRSSPSDDPSLPIAKVVLSIDPLNSNDDDSPQFTMELAGTEAGNIPKCYDMDMTTDFIPMSVFSDTPQGKISVEGKILNKFDMRPRNQSLELYGKLCRERTNKYMVKNRQIQVIDNDNGAHMRPMPGMIIMASAPSDKKKTPARGTEMKRTRRDRGEMEEIVFKLFERQSNWSLRNLIQETDQPEQFLKDILKDLCVYNNKGANQGTYELKPEYRKSGD*
• ORF Type: complete

Annotations of Ll_transcript_60725

• Blastp: General transcription factor IIF subunit 2 from Sophophora with 26.46% of identity
• Blastx: General transcription factor IIF subunit 2 from Bos with 30.77% of identity
• Eggnog: factor iif(COG5090)
• Kegg: Link to kegg annotations (Dmel_CG6538)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459446.1)
• Pfam: Transcription initiation factor IIF, beta subunit (PF02270.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;