Transcript | Ll_transcript_218233 |
---|---|
CDS coordinates | 97-582 (+) |
Peptide sequence | MIHFVLLISRQGKVRLAKWYSPYSQKERSKVIRELSGVIISRAPKLCNFVEWRGLKVVYKRYASLYFCICNDQEDNELETLSIIHHYVETLDRYFGSVCELDLIFNFHKAYFLLDEILLAGEMQETSKRTILRLISAQEDLVEAAKEEASSLSNIIAQATK* |
ORF Type | complete |
Blastp | AP-1 complex subunit sigma-2 from Arabidopsis with 83.75% of identity |
---|---|
Blastx | AP-1 complex subunit sigma-2 from Arabidopsis with 83.75% of identity |
Eggnog | Adaptor-related protein complex(COG5030) |
Kegg | Link to kegg annotations (AT4G35410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434339.1) |
Pfam | Clathrin adaptor complex small chain (PF01217.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer