Protein coding transcript 212826

• Transcript: Ll_transcript_218074
• CDS coordinates: 2-1036 (+)
• Peptide sequence: SSFHSFSSHTRYSVLSTYTTKEFSSMDTIRALVFVFFFAASVSGSLVYNFYEASCPAAELIVRNTVTSSSFQDPSIPAKLLRLLFHDCFVEGCDASVMLEGNNTEQSDPANRSVGGFSVIESAKRVLEVYCPGTVSCADIIALAARDAVEIVGGPMIPIPTGRRDGMVSLASNVRSNIVDTSFTMDDMINHFSTKGLSLVDLVILSGGHTIGTAHCSSFRNRFKEESNGKFSLIDNNTLDSTYGDELMRKCSSVANPSVTVNNDPQTSMLFDNQYYKNLLSNKGLFQSDSVLINDDRTSKLVGDLANDQDLFFQNWAQSFLKLTNVGVKTGDEGEVRVSCATSK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_218074

• Blastp: Peroxidase 18 from Arabidopsis with 63.97% of identity
• Blastx: Peroxidase 18 from Arabidopsis with 64.07% of identity
• Eggnog: peroxidase(ENOG410Y94T)
• Kegg: Link to kegg annotations (AT2G24800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003550235.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;