Protein coding transcript 212875

• Transcript: Ll_transcript_217410
• CDS coordinates: 3-308 (+)
• Peptide sequence: GGGGGGGGSSSGDEERRMEEGERSSLGGKRWPRQETLALLRIRSDMDVAFRDASVKAPLWEQVSRFNNFISLLASSHSFHLLQCKLWCSMNHTLNSRVVEI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_217410

• Blastp: Trihelix transcription factor GT-2 from Arabidopsis with 71.11% of identity
• Blastx: Trihelix transcription factor GTL1 from Arabidopsis with 83.33% of identity
• Eggnog: chromatin binding(ENOG410YBXG)
• Kegg: Link to kegg annotations (AT1G76890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451794.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;