Transcript | Ll_transcript_219286 |
---|---|
CDS coordinates | 1759-2919 (+) |
Peptide sequence | MMKKWIYVQCIRAHTHDVRALTVAVPITQEDALPDERVKRARREEKPVEFSYHKWAHLGVPMLISAGDDTKLFAYPVKEFTKFSPHDICPAPQRTPIQLVLNTAFNQSSMLLVQSSHGLDIHLLQLRNIHTAGGRAKTEMLARVKSKASQKIICSTISNSGMLFAYSDHLKPNLFELKRSEGGKVTWSVSKRKLPSRLPFAHSMIFTHDSSWLIVAGHDRRIYVVDVGSAELVHTFTPCRDLQDEKLPPTEPPITRLFSSSDKQWLSAVNCFGDIYVFNLEILRQHWFISRLDGASVTAGGFPPQNSNVMIITTSSNQVYAFDIEAKELGEWSKRHTYVLPRRYQEFPGEVIGLSFPPSSSSSSAVVYSSRYVFTQIYKSHFALLK* |
ORF Type | complete |
Blastp | U3 small nucleolar RNA-associated protein 4 homolog from Mus with 27.57% of identity |
---|---|
Blastx | U3 small nucleolar RNA-associated protein 4 homolog from Mus with 27.57% of identity |
Eggnog | cirrhosis, autosomal recessive 1A (cirhin)(ENOG410XQNR) |
Kegg | Link to kegg annotations (21771) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436965.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer