Protein coding transcript 212902

• Transcript: Ll_transcript_219288
• CDS coordinates: 3-1208 (+)
• Peptide sequence: DGLIRCWDVISGHEVYRITAGLGGLGSGHDLCIWSLLSLRSGALVSADSSGTVQFWDSHHGTLLQAHSLHKGDVNALAAAPSHDRVFSAGSDGQVILYKLSSQPASSDGVNSPIMMKKWIYVQCIRAHTHDVRALTVAVPITQEDALPDERVKRARREEKPVEFSYHKWAHLGVPMLISAGDDTKLFAYPVKEFTKFSPHDICPAPQRTPIQLVLNTAFNQSSMLLVQSSHGLDIHLLQLRNIHTAGGRAKTEMLARVKSKASQKIICSTISNSGMLFAYSDHLKPNLFELKRSEGGKVTWSVSKRKLPSRLPFAHSMIFTHDSSWLIVAGHDRRIYVVDVGSAELVHTFTPCRDLQDEKLPPTEPPITRLFSSSDKQWLSAVNCFGDIYVFNLEILRCSL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_219288

• Blastp: U3 small nucleolar RNA-associated protein 4 homolog from Mus with 27.65% of identity
• Blastx: U3 small nucleolar RNA-associated protein 4 homolog from Mus with 27.65% of identity
• Eggnog: cirrhosis, autosomal recessive 1A (cirhin)(ENOG410XQNR)
• Kegg: Link to kegg annotations (21771)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436965.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;