Protein coding transcript 212976

• Transcript: Ll_transcript_219366
• CDS coordinates: 138-839 (+)
• Peptide sequence: MGSCFTIHRNTKTTAAAAATNMKVKLSSSESKTVNFVIPPSPVKENNKNRSFDWSNPQSNTTPNGSKDEAFFDSKAVLDSDCEDDFYSVNGDFTPSRDNTPTHNTFGTPGYNNNPFANRIQGSMHVPSPRKNERKKLIDLFRESVEDDQDGGMKEAKPTLQDVLPKSELSTPFSSTNSAWSSEITGSEDTVSTRETSIKSVKSSRWCLPFPGSSSRRSFRERRRKVKSCNSSE*
• ORF Type: complete

Annotations of Ll_transcript_219366

• Blastp: Uncharacterized protein At3g27210 from Arabidopsis with 38.55% of identity
• Blastx: Uncharacterized protein At3g27210 from Arabidopsis with 48.19% of identity
• Eggnog: NA(ENOG410YNTS)
• Kegg: Link to kegg annotations (AT3G27210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428576.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;