Transcript | Ll_transcript_219375 |
---|---|
CDS coordinates | 2-502 (+) |
Peptide sequence | KEEAFFDSKAWLDSDCEDDFYSVNGDFTPSRGNTPIHHTFGTPGRNKTPFENRIHGSMHVPSPEKKKNLLDLFRESIRDDRDGGNGKKEAKPTIQDVLPKSAQSTPISGTNSAWSSERITSEDRASMKKSVKSAQWCIPVPGLSSCRSFSERRRKSSPAISVNGKH* |
ORF Type | 5prime_partial |
Blastp | Uncharacterized protein At3g27210 from Arabidopsis with 40.8% of identity |
---|---|
Blastx | Uncharacterized protein At3g27210 from Arabidopsis with 40.8% of identity |
Eggnog | NA(ENOG410YNTS) |
Kegg | Link to kegg annotations (AT3G27210) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453106.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer