Protein coding transcript 212979

• Transcript: Ll_transcript_219375
• CDS coordinates: 2-502 (+)
• Peptide sequence: KEEAFFDSKAWLDSDCEDDFYSVNGDFTPSRGNTPIHHTFGTPGRNKTPFENRIHGSMHVPSPEKKKNLLDLFRESIRDDRDGGNGKKEAKPTIQDVLPKSAQSTPISGTNSAWSSERITSEDRASMKKSVKSAQWCIPVPGLSSCRSFSERRRKSSPAISVNGKH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_219375

• Blastp: Uncharacterized protein At3g27210 from Arabidopsis with 40.8% of identity
• Blastx: Uncharacterized protein At3g27210 from Arabidopsis with 40.8% of identity
• Eggnog: NA(ENOG410YNTS)
• Kegg: Link to kegg annotations (AT3G27210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453106.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;