Protein coding transcript 213017

• Transcript: Ll_transcript_219967
• CDS coordinates: 611-913 (+)
• Peptide sequence: MNQSKKHLEFMDLSLGRNNKNNEANFQQGVVIGGGCGISTNTTPHDATCSSSISSTNNNNDEREHMFEKVVTPSDVGKLNRLVIPKQHAEKYFPLDSSSNE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_219967

• Blastp: B3 domain-containing protein Os03g0120900 from Oryza sativa with 90% of identity
• Blastx: B3 domain-containing protein Os04g0581400 from Oryza sativa with 90% of identity
• Eggnog: B3 domain-containing(ENOG410YHK7)
• Kegg: Link to kegg annotations (4331436)
• CantataDB: Link to cantataDB annotations (CNT0001952)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440470.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;