Protein coding transcript 213018

• Transcript: Ll_transcript_219969
• CDS coordinates: 34-876 (+)
• Peptide sequence: MNNNNHHHHHHHQHPHPFNHGSGCNNNNNNNVFPIPNPYYDHHHQQQQQHVNHFNNNHSMPPRPFRKRGWHQGDQVDGCSHVKVYVAPVPRTSTEADVRLVFEVHGTIIEVVLLKDKSTGARQGSCLVKYATLDEADRAIKALNNQYTFPGEATPVVVRYADRERERLGVQRNLEMKGRLKEVMVHKVYVGHINKEASKKDFEDIFSPYGHVEEVFIPYLRGYAFVKYSSREMASAAIEGLNGKFTMRVKLIYHLIHISLSDFECVLKIYFYSCRDVTLH*
• ORF Type: complete

Annotations of Ll_transcript_219969

• Blastp: Flowering time control protein FCA from Arabidopsis with 51.11% of identity
• Blastx: Flowering time control protein FCA from Arabidopsis with 52.22% of identity
• Eggnog: CUGBP, Elav-like family member(ENOG410XNTW)
• Kegg: Link to kegg annotations (AT4G16280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438215.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;