Transcript | Ll_transcript_219945 |
---|---|
CDS coordinates | 34-777 (+) |
Peptide sequence | MNNNNHHHHHHHQHPHPFNHGSGCNNNNNNNVFPIPNPYYDHHHQQQQQHVNHFNNNHSMPPRPFRKRGWHQGDQVDGCSHVKVYVAPVPRTSTEADVRLVFEVHGTIIEVVLLKDKSTGARQGSCLVKYATLDEADRAIKALNNQYTFPGEATPVVVRYADRERERLGVQRNLEMKGRLKEVMVHKVYVGHINKEASKKDFEDIFSPYGHVEEVFIPYLRGWSMILSFNVLHMISKALNNWQDFLF* |
ORF Type | complete |
Blastp | Flowering time control protein FCA from Arabidopsis with 48.39% of identity |
---|---|
Blastx | Flowering time control protein FCA from Arabidopsis with 51.39% of identity |
Eggnog | CUGBP, Elav-like family member(ENOG410XNTW) |
Kegg | Link to kegg annotations (AT4G16280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438217.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer