Protein coding transcript 213075

• Transcript: Ll_transcript_218313
• CDS coordinates: 177-572 (+)
• Peptide sequence: MAPFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRYLFFLFISLF*
• ORF Type: complete

Annotations of Ll_transcript_218313

• Blastp: V-type proton ATPase 16 kDa proteolipid subunit from Vigna with 99.17% of identity
• Blastx: V-type proton ATPase 16 kDa proteolipid subunit from Vigna with 99.17% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (106780537)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006592081.1)
• Pfam: ATP synthase subunit C (PF00137.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;