Protein coding transcript 213077

• Transcript: Ll_transcript_218315
• CDS coordinates: 1-435 (+)
• Peptide sequence: FHSPKLKTTMTAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRYLSLFHFMSSHLLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_218315

• Blastp: V-type proton ATPase subunit c5 from Arabidopsis with 98.35% of identity
• Blastx: V-type proton ATPase subunit c5 from Arabidopsis with 98.35% of identity
• Eggnog: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity)(COG0636)
• Kegg: Link to kegg annotations (AT2G16510)
• CantataDB: Link to cantataDB annotations (CNT0000133)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020978713.1)
• Pfam: ATP synthase subunit C (PF00137.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;