Transcript | Ll_transcript_218993 |
---|---|
CDS coordinates | 111-494 (+) |
Peptide sequence | MKANGSVHSHFLSLHAFGCSFTWFSYGFCSVIDSDNILLRLFLLQRVKPWQMNMALNFFETSAKTNLNVDEVFFSIARDIKQRLADTDSKAEVFVLNSLPIHEGLSYGCLHNFLVLYYLIKCKTHHY* |
ORF Type | complete |
Blastp | Ras-related protein RABE1a from Arabidopsis with 81.58% of identity |
---|---|
Blastx | Ras-related protein RABE1c from Arabidopsis with 61.05% of identity |
Eggnog | member RAS oncogene family(ENOG410XPUI) |
Kegg | Link to kegg annotations (AT3G53610) |
CantataDB | - |
Mirbase | mtr-MIR2589 (MI0011807) |
Ncbi protein | Link to NCBI protein (XP_012569725.1) |
Pfam | Ras family (PF00071.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer