Protein coding transcript 213219

• Transcript: Ll_transcript_218987
• CDS coordinates: 2-589 (+)
• Peptide sequence: YGLCGERAAILPGNASHYGLHPQMEHYSCMVDLLGRSGKANEALKLIESMPFEADDVIWRTLLSNCKIPENEEEAEKAANSLLKLDPQDASAYVLLSNIYANAGLWSEVAKIRTIMKSHKLKKEPGCSWIEIRDEVHAFVVGDKAHPRSEEIYEQTHLLVDEMKWVGDVPDFDFMLDEDMEELDPYERLETTSVV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_218987

• Blastp: Pentatricopeptide repeat-containing protein At3g02330, mitochondrial from Arabidopsis with 58.82% of identity
• Blastx: Pentatricopeptide repeat-containing protein At3g02330, mitochondrial from Arabidopsis with 63.16% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT3G02330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454632.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;