Protein coding transcript 213330

• Transcript: Ll_transcript_218536
• CDS coordinates: 543-848 (+)
• Peptide sequence: MLCICRWANIKLGLNMPAKVERTVRRSDCELQLVGEPIGEFYEVVLFFGIIDILQDYDISKKLEHAYKSIQYDPTSISAVDPRQYSKRFRDFIFRVFSEDS*
• ORF Type: complete

Annotations of Ll_transcript_218536

• Blastp: Phosphatidylinositol 4-phosphate 5-kinase 6 from Arabidopsis with 78.22% of identity
• Blastx: Phosphatidylinositol 4-phosphate 5-kinase 4 from Arabidopsis with 82.47% of identity
• Eggnog: whole genome shotgun sequence(COG4642)
• Kegg: Link to kegg annotations (AT3G07960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429714.1)
• Pfam: Phosphatidylinositol-4-phosphate 5-Kinase (PF01504.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;