Protein coding transcript 213339

• Transcript: Ll_transcript_218551
• CDS coordinates: 1-387 (+)
• Peptide sequence: LPSQKRLAVWRSTKGGDSGKNRRTSVDGRVSSEGAERTPDRTNLCDEGNVSAGPRTSTVGCDLDEELMALQVDNLDDIVAQLQPLKAPKKSKRQGETICKGHKNYELMLNLQLGIRYICVLDCPNLLK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_218551

• Blastp: Phosphatidylinositol 4-phosphate 5-kinase 5 from Arabidopsis with 50.43% of identity
• Blastx: Phosphatidylinositol 4-phosphate 5-kinase 5 from Arabidopsis with 48.39% of identity
• Eggnog: whole genome shotgun sequence(COG4642)
• Kegg: Link to kegg annotations (AT2G41210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437058.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;