Protein coding transcript 213351

• Transcript: Ll_transcript_218858
• CDS coordinates: 179-1075 (+)
• Peptide sequence: MLGGEEGEASAGAGHRRTYSRSVSWTDRAPSSRKPPNKSRSLLPSLQPLSINKRSVQEWPSAGSDDLGVWPLPQTPRGSIRSTEPGAMKEFQFKREKLAFYDKECSRIAEHVYLGSDTVAKNHELLRQNGITHVLNCVGFVCPEYFKSDFVYKTLWLKDSPTEDITSILYDVFDYFEDVREQGGRVLVHCCQGVSRSTSLVIAYLMWREGQSFEDAFQYVKNARGVTNPNMGFACQLLQCQKRVHAMPASPNSIRRIYRMAPHSPYDPLHLVPKMVNQPCAQTLDCRGAFIIHVPSAIY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_218858

• Blastp: Protein-tyrosine-phosphatase MKP1 from Arabidopsis with 58.43% of identity
• Blastx: Protein-tyrosine-phosphatase MKP1 from Arabidopsis with 68.85% of identity
• Eggnog: dual specificity phosphatase(COG2453)
• Kegg: Link to kegg annotations (AT3G55270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464014.1)
• Pfam: Dual specificity phosphatase, catalytic domain (PF00782.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;