| Transcript | Ll_transcript_218846 |
|---|---|
| CDS coordinates | 137-634 (+) |
| Peptide sequence | MIQLEPVSEYPFDFKKKIDGDESSEQFDPSPYGDDGSLEIEYLSLADVRIVKHGNPDSATVIAPSDAWVNLVKSTNGSIDEKLVGDQTKVGNSQEREGHTPAKDNGKVNLWDELNEALAAKKAKLSEVDDGWSHVSSDSRSWSHRALRCSALGPTMARLRAQNGL* |
| ORF Type | complete |
| Blastp | Coilin from Arabidopsis with 43.98% of identity |
|---|---|
| Blastx | Coilin from Arabidopsis with 43.09% of identity |
| Eggnog | NA(ENOG410ZKQA) |
| Kegg | Link to kegg annotations (AT1G13030) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019416523.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer