Transcript | Ll_transcript_218701 |
---|---|
CDS coordinates | 200-706 (+) |
Peptide sequence | MPILPFLRSSSHLTKQNRSNTFNLFPLLSFSTTTAAAISEQHHSPPPIRVALTHSSGRGVFATRPIATGDLIHTAKPALCHPSLSAINSVCYSCLKKVPNSNSFQYQGVLFCSQDCKRRCNEYYDVEMKANWTAFDDYCRYEHFFIKHQKIGINCYGFFYIISNFSLE* |
ORF Type | complete |
Blastp | Histone-lysine N-methyltransferase ATXR4 from Arabidopsis with 50.42% of identity |
---|---|
Blastx | Histone-lysine N-methyltransferase ATXR4 from Arabidopsis with 50.42% of identity |
Eggnog | Histone-lysine N-methyltransferase(COG2940) |
Kegg | Link to kegg annotations (AT5G06620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442963.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer