Protein coding transcript 213411

• Transcript: Ll_transcript_218701
• CDS coordinates: 200-706 (+)
• Peptide sequence: MPILPFLRSSSHLTKQNRSNTFNLFPLLSFSTTTAAAISEQHHSPPPIRVALTHSSGRGVFATRPIATGDLIHTAKPALCHPSLSAINSVCYSCLKKVPNSNSFQYQGVLFCSQDCKRRCNEYYDVEMKANWTAFDDYCRYEHFFIKHQKIGINCYGFFYIISNFSLE*
• ORF Type: complete

Annotations of Ll_transcript_218701

• Blastp: Histone-lysine N-methyltransferase ATXR4 from Arabidopsis with 50.42% of identity
• Blastx: Histone-lysine N-methyltransferase ATXR4 from Arabidopsis with 50.42% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT5G06620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442963.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;