Protein coding transcript 213612

• Transcript: Ll_transcript_220196
• CDS coordinates: 907-1440 (+)
• Peptide sequence: MSATYLFPDHALEVDLMLHLCLRIPWNGKQDILIDRFDGRALLDFIRESGHRRVQEKTEEEEELEEFVNFERYRDLVKHRRRGFTDEEALHHVNQEMEAKAAAPFASDKSNLSQPAASKGSYSQVGFSYDGNGKEESQFSDDDDNEEDEDEEDDEDFNSDDNEEDEDEEDDEDFNSDD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_220196

• Blastp: CLK4-associating serine/arginine rich protein from Bos with 37.14% of identity
• Blastx: -
• Eggnog: Molybdenum cofactor synthesis domain protein(COG0303)
• Kegg: Link to kegg annotations (509208)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444693.1)
• Pfam: Alternative splicing regulator (PF09750.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;