Transcript | Ll_transcript_220196 |
---|---|
CDS coordinates | 907-1440 (+) |
Peptide sequence | MSATYLFPDHALEVDLMLHLCLRIPWNGKQDILIDRFDGRALLDFIRESGHRRVQEKTEEEEELEEFVNFERYRDLVKHRRRGFTDEEALHHVNQEMEAKAAAPFASDKSNLSQPAASKGSYSQVGFSYDGNGKEESQFSDDDDNEEDEDEEDDEDFNSDDNEEDEDEEDDEDFNSDD |
ORF Type | 3prime_partial |
Blastp | CLK4-associating serine/arginine rich protein from Bos with 37.14% of identity |
---|---|
Blastx | - |
Eggnog | Molybdenum cofactor synthesis domain protein(COG0303) |
Kegg | Link to kegg annotations (509208) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444693.1) |
Pfam | Alternative splicing regulator (PF09750.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer