Protein coding transcript 213659

• Transcript: Ll_transcript_219648
• CDS coordinates: 106-639 (+)
• Peptide sequence: MIHSLPIIHKVEVPPKQTLLQEFEHNVKEIFFSDNPLSKFKNQNGSRKFVLCLHSVFPIFDWGRSYNLQTFRYDFIAGITIASLCIPQDIAYARLANLDPQYGLYTSFVTPLVYAFMGSSRDIAIGPVAVVSLLLGTSLSDEIKDFHTHDYLRLAFTATFFAGVTQMALGVLRYKLN*
• ORF Type: complete

Annotations of Ll_transcript_219648

• Blastp: High affinity sulfate transporter 2 from Stylosanthes with 73.53% of identity
• Blastx: High affinity sulfate transporter 2 from Stylosanthes with 55.87% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419720.1)
• Pfam: Sulfate permease family (PF00916.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;