Transcript | Ll_transcript_219628 |
---|---|
CDS coordinates | 1170-1814 (+) |
Peptide sequence | MSQRISDEVVAGAMGEPRSGPPSARYGNALPHDHKVLPPPKKTLFEDIKHSMKEIFFSDNPAKEFKNKTTGRKFVLGLESVFPILSWARGYSFKSFRGDFISGLTIASLCIPQDIAYAKLANLDPQYGLYTSFVAPLVYAFMGSSRDIAIGPVAVVSLLLGTSLSDEIKDFHTHDYLRLAFTATFFAGVTQMALGVLRLGFLIDFLSMISIDEN* |
ORF Type | complete |
Blastp | High affinity sulfate transporter 2 from Stylosanthes with 68.52% of identity |
---|---|
Blastx | High affinity sulfate transporter 2 from Stylosanthes with 68.52% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426073.1) |
Pfam | Sulfate permease family (PF00916.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer