Transcript | Ll_transcript_219919 |
---|---|
CDS coordinates | 103-645 (+) |
Peptide sequence | MYLFQLVVPDCFKLTIEGILFNLRALKSSGTPGIKHLRIGGLTGVSRVTEQQFEEFKELLDGSKYLQHGDQKPQFYRRGYSHIICEDGRAIDIEFCPRCQKLRPVYDCPAESCQQKHQSAQLCRGCTLCIARCMNCGRCIKDFDYEETFCLDLLCLNCWNQFLHCPEKSLCCIHFIKEVA* |
ORF Type | complete |
Blastp | F-box protein SKIP14 from Arabidopsis with 48.72% of identity |
---|---|
Blastx | F-box protein SKIP14 from Arabidopsis with 48.72% of identity |
Eggnog | F-box protein(ENOG410YFZ3) |
Kegg | Link to kegg annotations (AT3G26000) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428797.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer