Protein coding transcript 213682

• Transcript: Ll_transcript_219919
• CDS coordinates: 103-645 (+)
• Peptide sequence: MYLFQLVVPDCFKLTIEGILFNLRALKSSGTPGIKHLRIGGLTGVSRVTEQQFEEFKELLDGSKYLQHGDQKPQFYRRGYSHIICEDGRAIDIEFCPRCQKLRPVYDCPAESCQQKHQSAQLCRGCTLCIARCMNCGRCIKDFDYEETFCLDLLCLNCWNQFLHCPEKSLCCIHFIKEVA*
• ORF Type: complete

Annotations of Ll_transcript_219919

• Blastp: F-box protein SKIP14 from Arabidopsis with 48.72% of identity
• Blastx: F-box protein SKIP14 from Arabidopsis with 48.72% of identity
• Eggnog: F-box protein(ENOG410YFZ3)
• Kegg: Link to kegg annotations (AT3G26000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428797.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;