Protein coding transcript 213698

• Transcript: Ll_transcript_218511
• CDS coordinates: 301-1116 (+)
• Peptide sequence: MHDVGRFLNRLLGLPPEIQNRLFELFVSVLDLLVQNARIEGNLDAGIVDLKANVIELQGTPKTVHVDQMTGASTVLFTFILDRGITWESASTMLNEKQKDGLGSSNDGFYESKREWMGKRHVILAFESSDSGMYKIVRPPVGESIREMPLSELKTKYRKVSSLEKAQTGWEEEYEISSKQCMHGPKCKIGNFCTVGRRLQEVNVLGGLILPVWGAIEKALAKQARLSHRRLRVVRIETTTVDNQRIVGLLVPNAAVETVLQGLAWVQEIDD*
• ORF Type: complete

Annotations of Ll_transcript_218511

• Blastp: Protein FORGETTER 1 from Arabidopsis with 80.44% of identity
• Blastx: Protein FORGETTER 1 from Arabidopsis with 77.74% of identity
• Eggnog: Strawberry notch homolog(ENOG410XQ7Q)
• Kegg: Link to kegg annotations (AT1G79350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432320.1)
• Pfam: C-terminal domain on Strawberry notch homologue (PF13871.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;