Protein coding transcript 21372

• Transcript: Ll_transcript_319815
• CDS coordinates: 3-977 (+)
• Peptide sequence: SNTTMAVASRFMCTTLTHHGFSSTTHRTHLGHAQLTLSSRKNQIIHCSVSASDATKTSSVMEPVIPWGCDIDSVEIASALQKWLSESGLPPQKMGIQRVDVGERGLVALKNIRKREKLLFVPPSLVITADSEWSCPEAGEVLKRNSVPDWPFIATYLISEASRMKSSRWSNYISALPRQPYSLLYWSQAELDRYLEASQIRERAIERINNVIGTYNDLRLRIFSKYPDLFPEEVFNIDSFIWSFGILFSRMVRLPSMDGKVALVPWADMLNHSCDVGTYLDYDKSSKGIVFTTDRVYQPGVYFIWKKIKWRASVILWICSKGRC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_319815

• Blastp: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic from Pisum with 33.33% of identity
• Blastx: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic from Pisum with 35.68% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAA69903)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420730.1)
• Pfam: SET domain (PF00856.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;