Transcript | Ll_transcript_217533 |
---|---|
CDS coordinates | 176-622 (+) |
Peptide sequence | MNGKAPQTILTDQNICLKEALSMEMPTTKHAFCIWMIVAKFPSWFNAVLGERYNEWKAEFYRIYNLESIEDFELGWREMVCSFGLHSNRHMVTLYSSRSFWALPFLRSHFLAGMTTTGQSKSINAFIQRFLSAQTRLAHFVEQVAVAVD |
ORF Type | 3prime_partial |
Blastp | Protein FAR1-RELATED SEQUENCE 11 from Arabidopsis with 80.54% of identity |
---|---|
Blastx | Protein FAR1-RELATED SEQUENCE 11 from Arabidopsis with 78.62% of identity |
Eggnog | protein FAR1-RELATED SEQUENCE(ENOG410YDZ2) |
Kegg | Link to kegg annotations (AT1G10240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440413.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer