Transcript | Ll_transcript_217539 |
---|---|
CDS coordinates | 143-712 (+) |
Peptide sequence | MQQNLQNVCLKTGAPMESHAATILTPFAFSKLQEQLVLAAHYASFPIEDGFLVRHHTKAEGGRKVYWAPQEGIISCSCHQFDFSGILCRHSLRVLSTGNCFQIPDRYLPIRWRRISMPSSKLLQSAPNDHAERVQLLQNMVSSLITESAKSKERLDIATEQVSNLLSRIREQPISLQGVKDVSSINRNV* |
ORF Type | complete |
Blastp | Protein FAR1-RELATED SEQUENCE 11 from Arabidopsis with 76.19% of identity |
---|---|
Blastx | Protein FAR1-RELATED SEQUENCE 11 from Arabidopsis with 73.09% of identity |
Eggnog | protein FAR1-RELATED SEQUENCE(ENOG410YDZ2) |
Kegg | Link to kegg annotations (AT1G10240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440413.1) |
Pfam | SWIM zinc finger (PF04434.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer