Protein coding transcript 213751

• Transcript: Ll_transcript_217563
• CDS coordinates: 394-783 (+)
• Peptide sequence: MIISITGATGFIGRRLVQRLHADNHSVHVLTRSKSKAQEIFPVKDFPGIKIAGEPEWKDSIQGSTGVVNLAGLPISTRWSSEIKKEIKESRIRVTSKVVELINSSPDDTQPKVFVSATAVGYYGSSETQV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_217563

• Blastp: Epimerase family protein SDR39U1 homolog, chloroplastic from Arabidopsis with 77.69% of identity
• Blastx: Epimerase family protein SDR39U1 homolog, chloroplastic from Arabidopsis with 73.94% of identity
• Eggnog: Epimerase(COG1090)
• Kegg: Link to kegg annotations (AT2G21280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450999.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;