Protein coding transcript 21377

• Transcript: Ll_transcript_319825
• CDS coordinates: 3-563 (+)
• Peptide sequence: SNTTMAVASRFMCTTLTHHGFSSTTHRTHLGHAQLTLSSRKNQIIHCSVSASDATKTSSVMEPVIPWGCDIDSVEIASALQKWLSESGLPPQKMGIQRVDVGERGLVALKNIRKREKLLFVPPSLVITADSEWSCPEAGEVLKRNSVPDWPFIATYLISEASRMKSSRWSNYISALPRQPYSLLYW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_319825

• Blastp: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic from Pisum with 35.85% of identity
• Blastx: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic from Nicotiana with 30.11% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAA69903)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420730.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;