Protein coding transcript 2138

• Transcript: Ll_transcript_459065
• CDS coordinates: 154-525 (+)
• Peptide sequence: MLLFENFRQIIPPKIPQLAVIGYAETLSNLYANEIRSKWLAHFLDGNIKLPSIKNMGDEIQAWRDYMTLYSGKYYWKTCIFTCAIWYNDQLCKDMGLNHKRKKGFFAELFQPYGPADYVTLRP*
• ORF Type: complete

Annotations of Ll_transcript_459065

• Blastp: Probable flavin-containing monooxygenase 1 from Arabidopsis with 40.18% of identity
• Blastx: Probable flavin-containing monooxygenase 1 from Arabidopsis with 40.18% of identity
• Eggnog: Monooxygenase(COG2072)
• Kegg: Link to kegg annotations (AT1G19250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437515.1)
• Pfam: Flavin-binding monooxygenase-like (PF00743.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;