Protein coding transcript 21381

• Transcript: Ll_transcript_319836
• CDS coordinates: 2081-2482 (+)
• Peptide sequence: MLSFKKQCIELIDYYAPLFFSQVASAQPRELCKKVNLCPYSTKISSKVQENNCDFCKDTVTSLVVKLKDPDTELQILQTLLKVCDSMEKLKKNCKKMVLQYGPLLFLNAENFLKPEEICTALHACPATLVSDS*
• ORF Type: complete

Annotations of Ll_transcript_319836

• Blastp: Prosaposin from Bos with 29.1% of identity
• Blastx: Prosaposin from Bos with 28.07% of identity
• Eggnog: surfactant protein B(ENOG410XSI5)
• Kegg: Link to kegg annotations (281433)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459914.1)
• Pfam: Saposin-like type B, region 2 (PF03489.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;