Transcript | Ll_transcript_459100 |
---|---|
CDS coordinates | 32-487 (+) |
Peptide sequence | MALSGKVSIEFGIQATISQWFNLFHKNLNHVQNICERVHQAHVHEGDWHTIGSVKNWTFIIDGKPVKHKEKIEAIDESKKTITWSFFGEDLGQQYKVFILTLELNEKEDGSEVLKWTIEYELVNENVEPPYSYLDFLNKSSKHVDDYLVDA* |
ORF Type | complete |
Blastp | MLP-like protein 31 from Arabidopsis with 31.79% of identity |
---|---|
Blastx | MLP-like protein 31 from Arabidopsis with 31.79% of identity |
Eggnog | response to biotic stimulus(ENOG4111C37) |
Kegg | Link to kegg annotations (AT1G70840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418970.1) |
Pfam | Pathogenesis-related protein Bet v I family (PF00407.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer