Protein coding transcript 21390

• Transcript: Ll_transcript_320705
• CDS coordinates: 245-736 (+)
• Peptide sequence: MEGVSYARMPRVKIRELKDDYAKFELRDTDASIANALRRVMIAEVPTIAIDLVEIETNSSVLNDEFLAHRLGLIPLTSERAMSMRFSRDCDACDGDGQCEFCSVEFHLRVKCMTDQTLDVTSKDLISSDHTVTPVDFNDSSLIQSSDVNTNRYFFFFFFLGFR*
• ORF Type: complete

Annotations of Ll_transcript_320705

• Blastp: -
• Blastx: DNA-directed RNA polymerases II, IV and V subunit 3 from Arabidopsis with 81.08% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG0202)
• Kegg: Link to kegg annotations (AT2G15430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445856.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;