Protein coding transcript 213919

• Transcript: Ll_transcript_218022
• CDS coordinates: 222-587 (-)
• Peptide sequence: ETGVSNIEGGCYAKCIDLSKDKELDIWNAIKFGTVLENVVFDEHIREVDYADKSVTENTRAAYPIEYIPNAKLPCVGRHPKNVILLACDAFGVLPPVSKLSQISKPLKMNTSCKSSYITGY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_218022

• Blastp: Phosphoenolpyruvate carboxykinase (ATP) from Cucumis with 90.1% of identity
• Blastx: Phosphoenolpyruvate carboxykinase (ATP) from Cucumis with 90.1% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101222382)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004509722.1)
• Pfam: Phosphoenolpyruvate carboxykinase (PF01293.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;