Protein coding transcript 213939

• Transcript: Ll_transcript_218197
• CDS coordinates: 205-558 (+)
• Peptide sequence: MKGVVSSFEAVAGNGAAIVYSTLALKAMSRHFRCLKDGILGQIQETRKAMGEKEQGTPCTTKGETPRLRILDQTLRQQRTFQQMNMMETHPWRPQRGLPERSVSFLRAWLFEHFLHP*
• ORF Type: complete

Annotations of Ll_transcript_218197

• Blastp: BEL1-like homeodomain protein 2 from Arabidopsis with 60.83% of identity
• Blastx: BEL1-like homeodomain protein 2 from Arabidopsis with 60% of identity
• Eggnog: homeobox(ENOG410XPMQ)
• Kegg: Link to kegg annotations (AT4G36870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424333.1)
• Pfam: Associated with HOX (PF07526.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;