Transcript | Ll_transcript_218146 |
---|---|
CDS coordinates | 386-1138 (+) |
Peptide sequence | MDPLSLSNDAVSTLKDKESTVDPFLVEALQNPRHRLTILRMELDIQRFLNNADQQHFEFQHFPSSYLRLAAHRVAQYYGMQTMVQDNSLDGQGSKILVRKLAESKYPMVRLSEIPVKQLENDKSEQKKIVLKPRPNKNSFRDANEAGKKGNSWRSVEERKEEYDRARARIFSSSDSDDVQSLVPVDGKGSFMSKDENETSRIPVADSERSLSVRDVNSNRVAIFRDREKDRTDPDYDRSYGRLVLWSYLI* |
ORF Type | complete |
Blastp | R3H domain-containing protein 2 from Bos with 35.67% of identity |
---|---|
Blastx | R3H domain-containing protein 2 from Bos with 35.9% of identity |
Eggnog | cAMP-regulated phosphoprotein, 21kDa(ENOG4111U9N) |
Kegg | Link to kegg annotations (613499) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447121.1) |
Pfam | R3H domain (PF01424.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer