Protein coding transcript 213987

• Transcript: Ll_transcript_218146
• CDS coordinates: 386-1138 (+)
• Peptide sequence: MDPLSLSNDAVSTLKDKESTVDPFLVEALQNPRHRLTILRMELDIQRFLNNADQQHFEFQHFPSSYLRLAAHRVAQYYGMQTMVQDNSLDGQGSKILVRKLAESKYPMVRLSEIPVKQLENDKSEQKKIVLKPRPNKNSFRDANEAGKKGNSWRSVEERKEEYDRARARIFSSSDSDDVQSLVPVDGKGSFMSKDENETSRIPVADSERSLSVRDVNSNRVAIFRDREKDRTDPDYDRSYGRLVLWSYLI*
• ORF Type: complete

Annotations of Ll_transcript_218146

• Blastp: R3H domain-containing protein 2 from Bos with 35.67% of identity
• Blastx: R3H domain-containing protein 2 from Bos with 35.9% of identity
• Eggnog: cAMP-regulated phosphoprotein, 21kDa(ENOG4111U9N)
• Kegg: Link to kegg annotations (613499)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447121.1)
• Pfam: R3H domain (PF01424.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;