Protein coding transcript 21402

• Transcript: Ll_transcript_319307
• CDS coordinates: 443-937 (+)
• Peptide sequence: MEASGTSNMKFALNGCLIIGTLDGANVEIREEVGEDNFFLFGATAEDVPRLRKERENGLFKPDPRFEEAKKFIRSGVFGSYDYNPLLDSLEGDSGYGRGDYFLVGYDFPSYMDAQERVDEAYRDKKRWLKMSILSTAGSGKFSSDRTIAQYAKEIWNIQECRVP*
• ORF Type: complete

Annotations of Ll_transcript_319307

• Blastp: Alpha-glucan phosphorylase, H isozyme from Vicia with 94.51% of identity
• Blastx: Alpha-glucan phosphorylase, H isozyme from Vicia with 94.36% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449893.1)
• Pfam: Carbohydrate phosphorylase (PF00343.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;