Protein coding transcript 214045

• Transcript: Ll_transcript_218937
• CDS coordinates: 3-857 (+)
• Peptide sequence: LTGFQQAMTGVGSVLMTPLIGNLSDQYVILAYSRDTKFFYAYYVVKTLAAMAGEGSFQCLALAYVADKVPEGKRGSTFGVLAGVGSASFVGGTLAARFLSTALTFQVGAVFSMIALVYMRIFLEDSVPAGVGMTQPLLREGQEQCLQECESDSSKITTGTFKKLPSVGDLISMLKCSTTFSQAAVVLFLNSLVDGGLMASLLYYLKARFQFNKNQFADLMMITGIGATLTQIFFMPILVPAVGEAKLISMGLLVSCISMFVYSISWAGWVILFEHIVICLYTFL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_218937

• Blastp: Hippocampus abundant transcript 1 protein from Homo with 22.6% of identity
• Blastx: Hippocampus abundant transcript 1 protein from Mus with 22.6% of identity
• Eggnog: solute carrier family 46(ENOG410ZVCA)
• Kegg: Link to kegg annotations (64645)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441714.1)
• Pfam: Major Facilitator Superfamily (PF07690.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;