Protein coding transcript 214062

• Transcript: Ll_transcript_218251
• CDS coordinates: 299-913 (+)
• Peptide sequence: MSSDLIRPHITVHALMTACCRGFVDVIETLIKCGVDANATDRVLLQSLKPSLHTNVDCTPLVAAVIHRQVPVVGLLLQSGARIDSEVRLGAWSWDISTGEELRVGAGLGEPYGITWCAVEYFERSGAILRLLLQHASSNSPNCGRTLLHHAILCGNVEAVRTLLECGADPESPVKTTSKTEFLPIHMASRLGLPLIIQCLIDFGC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_218251

• Blastp: Ankyrin repeat and SOCS box protein 3 from Homo with 29.76% of identity
• Blastx: Ankyrin repeat and SOCS box protein 3 from Homo with 28.78% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (100302652)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458879.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;