Transcript | Ll_transcript_218261 |
---|---|
CDS coordinates | 224-736 (+) |
Peptide sequence | MLKTKAFIGSNVFMSRNLVPPEIFATLHDALNDNGAQIHLCCDPSRNATNDYHIISSNKHDKFEDLKAKGCKLIGPRCVLSCAKECRPLPKQGFTCCLAMDGVKLLASGFDMDEKVKIEELVTEMGGVLHAKASLDLNFVIVKNVLAAKYKVECFVLVLFTTKKEEKKYYT |
ORF Type | 3prime_partial |
Blastp | Protein ECT2 from Mus with 28.85% of identity |
---|---|
Blastx | Protein ECT2 from Mus with 28.85% of identity |
Eggnog | epithelial cell transforming sequence 2(ENOG410XRV9) |
Kegg | Link to kegg annotations (13605) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456412.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer