| Transcript | Ll_transcript_218269 |
|---|---|
| CDS coordinates | 224-790 (+) |
| Peptide sequence | MLKTKAFIGSNVFMSRNLVPPEIFATLHDALNDNGAQIHLCCDPSRNATNDYHIISSNKHDKFEDLKAKGCKLIGPRCVLSCAKECRPLPKQGFTCCLAMDGVKLLASGFDMDEKVKIEELVTEMGGVLHAKASLDLNFVIVKNVLAAKYKVCYVKFLVLTFILNQFTSNGSFFLYIIVFHSFSVLTS* |
| ORF Type | complete |
| Blastp | Protein ECT2 from Mus with 28.57% of identity |
|---|---|
| Blastx | - |
| Eggnog | epithelial cell transforming sequence 2(ENOG410XRV9) |
| Kegg | Link to kegg annotations (13605) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456412.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer